B500 is a synthetic version of the naturally occurring peptide present in virtually all human and animal cells, Thymosin Beta-4. It plays a role in the regulation of actin, which is a cell-building protein.
Synonyms: Thymosin beta 4, Timbetasin
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
IUPAC Condensed: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Molecular Weight: 4963 g/mol
CAS Number: 77591-33-4
PubChem CID: 16132341
Further references
PubChem https://pubchem.ncbi.nlm.nih.gov/compound/16132341
Stability: Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°c for a limited period of time. The lyophilised protein remains stable until expiry date when stored at -20°c.
Source: Biosynthesis
Reconstitution: Reconstitute with Bacteriostatic Water