Tesamorelin consists of the 44 amino acid sequence of human growth hormone releasing factor (GRF), with a 3-hexenoyl group attached to its tyrosine N-terminal residue.
Synonyms: Egrifta, TH9507
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
IUPAC Condensed: Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
Molecular Weight: 5136g/mol
CAS Number: 218949-48-5
PubChem CID: 16137828
Further references
PubChem https://pubchem.ncbi.nlm.nih.gov/compound/16137828
Stability: Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°c for a limited period of time. The lyophilised protein remains stable until expiry date when stored at -20°c.
Source: Biosynthesis
Reconstitution: Reconstitute with Bacteriostatic Water